Antibody data

Product number
H00006882-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006882-M03, RRID:AB_875870
Product name
TAF11 monoclonal antibody (M03), clone 3H5
Provider product page
Abnova Corporation - H00006882-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TAF11.
Antigen sequence
SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVR
RLKSKGQIPNSKHKKIIF
Isotype
IgG
Antibody clone number
3H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -