Antibody data

Product number
H00003248-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003248-M01, RRID:AB_1204498
Product name
HPGD monoclonal antibody (M01), clone 1D8
Provider product page
Abnova Corporation - H00003248-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant HPGD.
Antigen sequence
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALV
DWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQ
LRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQ
INLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLA
GLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSG
VRLNAICPGFVNTAILESIEKEENMGQYIEYKDHI
KDMIKYYGILDPPLIANGLITLIEDDALNGAIMKI
TTSKGIHFQDYDTTPFQAKTQ
Isotype
IgG
Antibody clone number
1D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -