HPA004919

HPGD antibody from Sigma-Aldrich
SDR36C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004919
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004919, RRID:AB_1079081
Product name
Anti-HPGD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004919
Antibody type
Polyclonal
Antigen
15-Hydroxyprostaglandin dehydrogenase [NAD+] recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQ
QLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTL
QINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSL
AGLMPVAQQPV
Storage
-20C
Provider Type Product Number
- No reagents -