HPA024261

OR2K2 antibody from Atlas Antibodies
HSHTPCRH06, HTPCRH06, OR2AR1P
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024261
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024261, RRID:AB_1854786
Product name
Anti-OR2K2
Provider product page
Atlas Antibodies - HPA024261
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIW
SIFFLEGFSQYPGLEV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -