PAB21671

OR2K2 antibody from Abnova Corporation
HSHTPCRH06, HTPCRH06, OR2AR1P

Antibody data

Product number
PAB21671
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21671, RRID:AB_10965607
Product name
OR2K2 polyclonal antibody
Provider product page
Abnova Corporation - PAB21671
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant OR2K2.
Antigen sequence
TLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIW
SIFFLEGFSQYPGLEV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -