HPA024261

OR2K2 antibody from Sigma-Aldrich
HSHTPCRH06, HTPCRH06, OR2AR1P
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024261
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024261, RRID:AB_1854786
Product name
Anti-OR2K2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024261
Antibody type
Polyclonal
Antigen
Olfactory receptor 2K2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIW
SIFFLEGFSQYPGLEV
Storage
-20C
Provider Type Product Number
- No reagents -