Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000642-A01 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000642-A01, RRID:AB_489533
- Product name
- BLMH polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant BLMH.
- Antigen sequence
- NMNKAERLTFGESLMTHAMTFTAVSEKDDQDGAFT
 KWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVD
 RKHVPEEVLAVLEQEPIILPAWDPMGALA
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references		Novel regulatory role for Kaposi's sarcoma-associated herpesvirus-encoded vFLIP in chemosensitization to bleomycin.
				
Paradoxical function for the receptor for advanced glycation end products in mouse models of pulmonary fibrosis.
				
		
	
			Masuda Y, Noguchi K, Segawa H, Tanaka N, Katayama K, Mitsuhashi J, Sugimoto Y
Biochemical and biophysical research communications 2011 Nov 18;415(2):305-12
		Biochemical and biophysical research communications 2011 Nov 18;415(2):305-12
Paradoxical function for the receptor for advanced glycation end products in mouse models of pulmonary fibrosis.
			Englert JM, Kliment CR, Ramsgaard L, Milutinovic PS, Crum L, Tobolewski JM, Oury TD
International journal of clinical and experimental pathology 2011 Mar;4(3):241-54
		International journal of clinical and experimental pathology 2011 Mar;4(3):241-54
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- BLMH polyclonal antibody (A01), Lot # 060111JC01 Western Blot analysis of BLMH expression in 293 ( Cat # L026V1 ).