Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000642-M02 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000642-M02, RRID:AB_1111695
- Product name
- BLMH monoclonal antibody (M02), clone 4A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BLMH.
- Antigen sequence
- NMNKAERLTFGESLMTHAMTFTAVSEKDDQDGAFT
 KWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVD
 RKHVPEEVLAVLEQEPIILPAWDPMGALA
- Isotype
- IgG
- Antibody clone number
- 4A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- BLMH monoclonal antibody (M02), clone 4A2. Western Blot analysis of BLMH expression in K-562 ( Cat # L009V1 ).
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged BLMH is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol