Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503844 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Bleomycin Hydrolase (BLMH) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BLMH antibody: synthetic peptide directed towards the middle region of human BLMH
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEA
VWFGC DVGKHFNSKL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Variation in bleomycin hydrolase gene is associated with reduced survival after chemotherapy for testicular germ cell cancer.
de Haas EC, Zwart N, Meijer C, Nuver J, Boezen HM, Suurmeijer AJ, Hoekstra HJ, van der Steege G, Sleijfer DT, Gietema JA
Journal of clinical oncology : official journal of the American Society of Clinical Oncology 2008 Apr 10;26(11):1817-23
Journal of clinical oncology : official journal of the American Society of Clinical Oncology 2008 Apr 10;26(11):1817-23
No comments: Submit comment
No validations: Submit validation data