Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20351 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20351, RRID:AB_10968379
- Product name
- SLC2A13 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant SLC2A13.
- Antigen sequence
ITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYK
MNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKT
EDI- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach with SLC2A13 polyclonal antibody (Cat # PAB20351) shows strong cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)