HPA006584

SLC2A13 antibody from Sigma-Aldrich
HMIT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006584
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006584, RRID:AB_1849755
Product name
Anti-SLC2A13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006584
Antibody type
Polyclonal
Antigen
Proton myo-inositol cotransporter recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYK
MNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKT
EDI
Storage
-20C
Provider Type Product Number
- No reagents -