Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021946 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TMIGD1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NGKTENYILDTTPGSQASLICAVQNHTREEELLWY
REEGRVDLKSGNKINSSSVCVSSISENDNGISFTC
RLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSN
VKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQI- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Membrane recruitment of the polarity protein Scribble by the cell adhesion receptor TMIGD1
The mitochondrial outer membrane protein SYNJ2BP interacts with the cell adhesion molecule TMIGD1 and can recruit it to mitochondria
Preinvasive colorectal lesion transcriptomes correlate with endoscopic morphology (polypoid vs. nonpolypoid)
Thüring E, Hartmann C, Maddumage J, Javorsky A, Michels B, Gerke V, Banks L, Humbert P, Kvansakul M, Ebnet K
Communications Biology 2023;6(1)
Communications Biology 2023;6(1)
The mitochondrial outer membrane protein SYNJ2BP interacts with the cell adhesion molecule TMIGD1 and can recruit it to mitochondria
Hartmann C, Schwietzer Y, Kummer D, Kirschnick N, Hoppe E, Thüring E, Glaesner-Ebnet M, Brinkmann F, Gerke V, Reuter S, Nakayama M, Ebnet K
BMC Molecular and Cell Biology 2020;21(1)
BMC Molecular and Cell Biology 2020;21(1)
Preinvasive colorectal lesion transcriptomes correlate with endoscopic morphology (polypoid vs. nonpolypoid)
Cattaneo E, Laczko E, Buffoli F, Zorzi F, Bianco M, Menigatti M, Bartosova Z, Haider R, Helmchen B, Sabates‐Bellver J, Tiwari A, Jiricny J, Marra G
EMBO Molecular Medicine 2011;3(6):334-347
EMBO Molecular Medicine 2011;3(6):334-347
No comments: Submit comment
No validations: Submit validation data