HPA021946

TMIGD1 antibody from Sigma-Aldrich
TMIGD, UNQ9372
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021946
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021946, RRID:AB_1858140
Product name
Anti-TMIGD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021946
Antibody type
Polyclonal
Antigen
Transmembrane and immunoglobulin domain-containing protein 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGKTENYILDTTPGSQASLICAVQNHTREEELLWY
REEGRVDLKSGNKINSSSVCVSSISENDNGISFTC
RLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSN
VKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQI
Storage
-20C
Provider Type Product Number
- No reagents -