HPA006680

NLGN1 antibody from Atlas Antibodies
KIAA1070
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006680
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006680, RRID:AB_1854400
Product name
Anti-NLGN1
Provider product page
Atlas Antibodies - HPA006680
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNL
NDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFP
TAKQDDPKQQPSPFSVDQRDYS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -