HPA006680

NLGN1 antibody from Sigma-Aldrich
KIAA1070
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006680
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006680, RRID:AB_1854400
Product name
Anti-NLGN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006680
Antibody type
Polyclonal
Antigen
Neuroligin-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNL
NDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFP
TAKQDDPKQQPSPFSVDQRDYS
Storage
-20C
Provider Type Product Number
- No reagents -