HPA007210

SLC18A1 antibody from Sigma-Aldrich
CGAT, VAT1, VMAT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007210
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007210, RRID:AB_1856999
Product name
Anti-SLC18A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007210
Antibody type
Polyclonal
Antigen
Chromaffin granule amine transporter recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFST
IFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPAT
EAISAHKNNCLQGTGFLEEEI
Storage
-20C
Provider Type Product Number
- No reagents -