HPA022035

CRTC1 antibody from Atlas Antibodies
FLJ14027, KIAA0616, MECT1, TORC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022035
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022035, RRID:AB_1847255
Product name
Anti-CRTC1
Provider product page
Atlas Antibodies - HPA022035
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQ
DVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKK
TGSRPKSCEV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -