HPA022035

CRTC1 antibody from Sigma-Aldrich
FLJ14027, KIAA0616, MECT1, TORC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022035
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022035, RRID:AB_1847255
Product name
Anti-CRTC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022035
Antibody type
Polyclonal
Antigen
CREB-regulated transcription coactivator 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQ
DVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKK
TGSRPKSCEV
Storage
-20C
Provider Type Product Number
- No reagents -