HPA019122

DNAJC25 antibody from Atlas Antibodies
bA16L21.2.1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019122
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019122, RRID:AB_1853155
Product name
Anti-DNAJC25
Provider product page
Atlas Antibodies - HPA019122
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQK
ETFLKRELWIKENYEVYKQEQEEELKKKLANDPRW
KRYRRWMKNEGPGRLTFVDD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -