HPA025039

EIF4G3 antibody from Sigma-Aldrich
eIF4GII
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025039
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025039, RRID:AB_1848103
Product name
Anti-EIF4G3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025039
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 4 gamma 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEEIMSGGGSRNPTPPIGRPTSTPTPPQQLPSQVP
EHSPVVYGTVESAHLAASTPVTAASDQKQEEKPKP
DPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVS
Storage
-20C
Provider Type Product Number
- No reagents -