HPA020590

GOSR1 antibody from Atlas Antibodies
GOLIM2, GOS-28, GOS28, GS28, P28
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020590
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020590, RRID:AB_1850374
Product name
Anti-GOSR1
Provider product page
Atlas Antibodies - HPA020590
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQ
DYTHEFHKTKANFMAIRERENLMGSVRKDIESYKS
GSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMA
TKENMTSQRGMLKSIHSKMNTLANRFPAVNSLIQR
INLRKR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -