HPA020590

GOSR1 antibody from Sigma-Aldrich
GOLIM2, GOS-28, GOS28, GS28, P28
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020590
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020590, RRID:AB_1850374
Product name
Anti-GOSR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020590
Antibody type
Polyclonal
Antigen
Golgi SNAP receptor complex member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQ
DYTHEFHKTKANFMAIRERENLMGSVRKDIESYKS
GSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMA
TKENMTSQRGMLKSIHSKMNTLANRFPAVNSLIQR
INLRKR
Storage
-20C
Provider Type Product Number
- No reagents -