HPA006879

SLIT1 antibody from Sigma-Aldrich
MEGF4, SLIL1, Slit-1, slit1, SLIT3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006879
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006879, RRID:AB_1078197
Product name
Anti-SLIT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006879
Antibody type
Polyclonal
Antigen
Slit homolog 1 protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QDFTKTQMKPGVVPGCEPCRKLYCLHGICQPNATP
GPMCHCEAGWVGLHCDQPADGPCHGHKCVHGQCVP
LDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCL
HGHCQASGTKGAHCVCDPGFS
Storage
-20C
Provider Type Product Number
- No reagents -