HPA019955

DNASE1L3 antibody from Sigma-Aldrich
DNAS1L3, LSD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019955
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019955, RRID:AB_1847805
Product name
Anti-DNASE1L3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019955
Antibody type
Polyclonal
Antigen
Deoxyribonuclease gamma Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEE
ALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTK
Storage
-20C
Provider Type Product Number
- No reagents -