HPA007179

PTPRN antibody from Sigma-Aldrich
IA-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007179
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007179, RRID:AB_1079714
Product name
Anti-PTPRN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007179
Antibody type
Polyclonal
Antigen
Receptor-type tyrosine-protein phosphatase-like N precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARV
PRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPA
VQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTL
LQLLPKGA
Storage
-20C
Provider Type Product Number
- No reagents -