Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000489-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000489-M01, RRID:AB_464308
- Product name
- ATP2A3 monoclonal antibody (M01), clone 2H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ATP2A3.
- Antigen sequence
TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTA
PLTPTSREQILAKIRDWGSGSDTLRCLALATRDAP
PRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRP
EVAACITRCYQAGIR- Isotype
- IgG
- Antibody clone number
- 2H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Loss of endoplasmic reticulum calcium pump expression in choroid plexus tumours.
Modulation of endoplasmic reticulum calcium pump expression during lung cancer cell differentiation.
Expression of sarco/endoplasmic reticulum Ca(2+) ATPase (SERCA) 3 proteins in two major conformational states in native human cell membranes.
Ait-Ghezali L, Arbabian A, Jeibmann A, Hasselblatt M, Hallaert GG, Van den Broecke C, Gray F, Brouland JP, Varin-Blank N, Papp B
Neuropathology and applied neurobiology 2014 Oct;40(6):726-35
Neuropathology and applied neurobiology 2014 Oct;40(6):726-35
Modulation of endoplasmic reticulum calcium pump expression during lung cancer cell differentiation.
Arbabian A, Brouland JP, Apáti Á, Pászty K, Hegedűs L, Enyedi Á, Chomienne C, Papp B
The FEBS journal 2013 Nov;280(21):5408-18
The FEBS journal 2013 Nov;280(21):5408-18
Expression of sarco/endoplasmic reticulum Ca(2+) ATPase (SERCA) 3 proteins in two major conformational states in native human cell membranes.
Corvazier E, Bredoux R, Kovács T, Enouf J
Biochimica et biophysica acta 2009 Mar;1788(3):587-99
Biochimica et biophysica acta 2009 Mar;1788(3):587-99
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ATP2A3 monoclonal antibody (M01), clone 2H3 Western Blot analysis of ATP2A3 expression in HL-60 ( Cat # L014V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ATP2A3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ATP2A3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol