HPA007180

ATP2A3 antibody from Sigma-Aldrich
SERCA3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007180
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007180, RRID:AB_1845177
Product name
Anti-ATP2A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007180
Antibody type
Polyclonal
Antigen
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVI
ERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSD
TLRCLALATRDAPPRKEDMELDDCSKFVQYE
Storage
-20C
Provider Type Product Number
- No reagents -