Antibody data

Product number
H00054899-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054899-M04, RRID:AB_1137403
Product name
PXK monoclonal antibody (M04), clone 4D11
Provider product page
Abnova Corporation - H00054899-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PXK.
Antigen sequence
PDSVPVDSFPPAPSMAVVAVLESTLSCEACKNGMP
TISRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALR
IAKECIEKRLIEEQKQIHQHRRLTRAQSHH
Isotype
IgG
Antibody clone number
4D11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -