Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007357-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007357-M03, RRID:AB_1716783
- Product name
- UGCG monoclonal antibody (M03), clone 1E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UGCG.
- Antigen sequence
TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLI
NNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLL
GKYPNVDARLFIGGKKVGINPKINNLMPG- Isotype
- IgG
- Antibody clone number
- 1E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Fenretinide sensitizes multidrug-resistant human neuroblastoma cells to antibody-independent and ch14.18-mediated NK cell cytotoxicity.
DNA damage induces down-regulation of UDP-glucose ceramide glucosyltransferase, increases ceramide levels and triggers apoptosis in p53-deficient cancer cells.
Shibina A, Seidel D, Somanchi SS, Lee DA, Stermann A, Maurer BJ, Lode HN, Reynolds CP, Huebener N
Journal of molecular medicine (Berlin, Germany) 2013 Apr;91(4):459-72
Journal of molecular medicine (Berlin, Germany) 2013 Apr;91(4):459-72
DNA damage induces down-regulation of UDP-glucose ceramide glucosyltransferase, increases ceramide levels and triggers apoptosis in p53-deficient cancer cells.
Haynes TA, Filippov V, Filippova M, Yang J, Zhang K, Duerksen-Hughes PJ
Biochimica et biophysica acta 2012 Jul;1821(7):943-53
Biochimica et biophysica acta 2012 Jul;1821(7):943-53
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UGCG monoclonal antibody (M03), clone 1E5. Western Blot analysis of UGCG expression in HL-60.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UGCG is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol