HPA012084

TACR2 antibody from Sigma-Aldrich
NK2R, NKNAR, SKR, TAC2R
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012084
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012084, RRID:AB_1857726
Product name
Anti-TACR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012084
Antibody type
Polyclonal
Antigen
Substance-K receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTR
VNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGL
WFGYGLLAPTKTHVEI
Storage
-20C
Provider Type Product Number
- No reagents -