HPA021576

RNF135 antibody from Sigma-Aldrich
MGC13061
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021576
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021576, RRID:AB_1856331
Product name
Anti-RNF135 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021576
Antibody type
Polyclonal
Antigen
RING finger protein 135 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSILGKAFSSGVDLSMASPKLVTSDTAAGKIRDIL
HDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSS
SCPLPDQSHPALRRASRFAQWAIHPTFNLK
Storage
-20C
Provider Type Product Number
- No reagents -