Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502208 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Neurotensin Receptor 1 (High Affinity) (NTSR1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAV
YLALF VVGTVGNTVT- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Neurotensin receptor binding and neurotensin-induced growth signaling in prostate cancer PC3 cells are sensitive to metabolic stress.
Isolation and partial sequence of elasmobranch VIP.
Carraway RE, Hassan S
Regulatory peptides 2007 Jun 7;141(1-3):140-53
Regulatory peptides 2007 Jun 7;141(1-3):140-53
Isolation and partial sequence of elasmobranch VIP.
Dimaline R, Thorndyke MC, Young J
Regulatory peptides 1986 Mar;14(1):1-10
Regulatory peptides 1986 Mar;14(1):1-10
No comments: Submit comment
No validations: Submit validation data