HPA002930

CGRRF1 antibody from Sigma-Aldrich
CGR19, RNF197
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002930
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002930, RRID:AB_1078507
Product name
Anti-CGRRF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002930
Antibody type
Polyclonal
Antigen
Cell growth regulator with RING finger domain protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQ
FHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEK
VGLSESEVEPSEENSKDCVVCQNGTVNWVLLPCRH
TCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDK
DKPK
Storage
-20C
Provider Type Product Number
- No reagents -