HPA002690

FBXO11 antibody from Sigma-Aldrich
FBX11, UBR6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002690
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002690, RRID:AB_1848448
Product name
Anti-FBXO11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002690
Antibody type
Polyclonal
Antigen
F-box only protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GHRAKRARVSGKSQDLSAAPAEQYLQEKLPDEVVL
KIFSYLLEQDLCRAACVCKRFSELANDPILWKRLY
MEVFEYTRPMMHPEPGKFYQINPEEYEHPNPWKES
FQQLYKGAHVKPGFAEHFYSNPARYKGR
Storage
-20C
Provider Type Product Number
- No reagents -