HPA018195

CFAP20 antibody from Sigma-Aldrich
C16orf80, fSAP23, GTL3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018195
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018195, RRID:AB_1850408
Product name
Anti-C16orf80 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018195
Antibody type
Polyclonal
Antigen
UPF0468 protein C16orf80 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQ
SLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVM
IIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTR
VKPFICTMPMRLDDGWNQIQFNLL
Storage
-20C
Provider Type Product Number
- No reagents -