HPA018195

CFAP20 antibody from Atlas Antibodies
C16orf80, fSAP23, GTL3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018195
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018195, RRID:AB_1850408
Product name
Anti-CFAP20
Provider product page
Atlas Antibodies - HPA018195
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQ
SLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVM
IIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTR
VKPFICTMPMRLDDGWNQIQFNLL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -