Antibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005094-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005094-M07, RRID:AB_530016
- Product name
- PCBP2 monoclonal antibody (M07), clone 5F12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PCBP2.
- Antigen sequence
MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGES
VKKMREESGARINISEGNCPERIITLAGPTNAIFK
AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVP
ASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN
STERAITIAGIPQSIIECVKQICVVMLESPPKGVT
IPYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTP
SMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQL
AMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDA
SAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSG
AQIKIANPVEGSTDRQVTITGSAASISLAQYLINV
RLSSETGGMGSS- Isotype
- IgG
- Antibody clone number
- 5F12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references hnRNP L and NF90 interact with hepatitis C virus 5'-terminal untranslated RNA and promote efficient replication.
Selenite targets eIF4E-binding protein-1 to inhibit translation initiation and induce the assembly of non-canonical stress granules.
Poly(C)-binding protein 2 interacts with sequences required for viral replication in the hepatitis C virus (HCV) 5' untranslated region and directs HCV RNA replication through circularizing the viral genome.
Identification of RNA helicase A as a new host factor in the replication cycle of foot-and-mouth disease virus.
Selective localization of PCBP2 to cytoplasmic processing bodies.
Rapid changes of mRNA-binding protein levels following glucose and 3-isobutyl-1-methylxanthine stimulation of insulinoma INS-1 cells.
Identification of PCBP2, a facilitator of IRES-mediated translation, as a novel constituent of stress granules and processing bodies.
A link between SIN1 (MAPKAP1) and poly(rC) binding protein 2 (PCBP2) in counteracting environmental stress.
Li Y, Masaki T, Shimakami T, Lemon SM
Journal of virology 2014 Jul;88(13):7199-209
Journal of virology 2014 Jul;88(13):7199-209
Selenite targets eIF4E-binding protein-1 to inhibit translation initiation and induce the assembly of non-canonical stress granules.
Fujimura K, Sasaki AT, Anderson P
Nucleic acids research 2012 Sep;40(16):8099-110
Nucleic acids research 2012 Sep;40(16):8099-110
Poly(C)-binding protein 2 interacts with sequences required for viral replication in the hepatitis C virus (HCV) 5' untranslated region and directs HCV RNA replication through circularizing the viral genome.
Wang L, Jeng KS, Lai MM
Journal of virology 2011 Aug;85(16):7954-64
Journal of virology 2011 Aug;85(16):7954-64
Identification of RNA helicase A as a new host factor in the replication cycle of foot-and-mouth disease virus.
Lawrence P, Rieder E
Journal of virology 2009 Nov;83(21):11356-66
Journal of virology 2009 Nov;83(21):11356-66
Selective localization of PCBP2 to cytoplasmic processing bodies.
Fujimura K, Katahira J, Kano F, Yoneda Y, Murata M
Biochimica et biophysica acta 2009 May;1793(5):878-87
Biochimica et biophysica acta 2009 May;1793(5):878-87
Rapid changes of mRNA-binding protein levels following glucose and 3-isobutyl-1-methylxanthine stimulation of insulinoma INS-1 cells.
Süss C, Czupalla C, Winter C, Pursche T, Knoch KP, Schroeder M, Hoflack B, Solimena M
Molecular & cellular proteomics : MCP 2009 Mar;8(3):393-408
Molecular & cellular proteomics : MCP 2009 Mar;8(3):393-408
Identification of PCBP2, a facilitator of IRES-mediated translation, as a novel constituent of stress granules and processing bodies.
Fujimura K, Kano F, Murata M
RNA (New York, N.Y.) 2008 Mar;14(3):425-31
RNA (New York, N.Y.) 2008 Mar;14(3):425-31
A link between SIN1 (MAPKAP1) and poly(rC) binding protein 2 (PCBP2) in counteracting environmental stress.
Ghosh D, Srivastava GP, Xu D, Schulz LC, Roberts RM
Proceedings of the National Academy of Sciences of the United States of America 2008 Aug 19;105(33):11673-8
Proceedings of the National Academy of Sciences of the United States of America 2008 Aug 19;105(33):11673-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PCBP2 monoclonal antibody (M07), clone 5F12 Western Blot analysis of PCBP2 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PCBP2 expression in transfected 293T cell line by PCBP2 monoclonal antibody (M07), clone 5F12.Lane 1: PCBP2 transfected lysate(38.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PCBP2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PCBP2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PCBP2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol