Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183983 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Poly(rC) Binding Protein 2 (PCBP2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PCBP2 antibody: synthetic peptide directed towards the middle region of human PCBP2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGP
PLEAY TIQGQYAIPQ- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references RNA-binding protein PCBP2 modulates glioma growth by regulating FHL3.
Transcriptome analysis of human gastric cancer.
Han W, Xin Z, Zhao Z, Bao W, Lin X, Yin B, Zhao J, Yuan J, Qiang B, Peng X
The Journal of clinical investigation 2013 May;123(5):2103-18
The Journal of clinical investigation 2013 May;123(5):2103-18
Transcriptome analysis of human gastric cancer.
Oh JH, Yang JO, Hahn Y, Kim MR, Byun SS, Jeon YJ, Kim JM, Song KS, Noh SM, Kim S, Yoo HS, Kim YS, Kim NS
Mammalian genome : official journal of the International Mammalian Genome Society 2005 Dec;16(12):942-54
Mammalian genome : official journal of the International Mammalian Genome Society 2005 Dec;16(12):942-54
No comments: Submit comment
No validations: Submit validation data