Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012122 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012122, RRID:AB_1848474
- Product name
- Anti-FCGRT
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKA
RPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGT
GQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQH
AGLAQPLRVELESPAKS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Enhanced neonatal Fc receptor function improves protection against primate SHIV infection.
Robust Expression of the Human Neonatal Fc Receptor in a Truncated Soluble Form and as a Full-Length Membrane-Bound Protein in Fusion with eGFP
Neonatal Fc receptor expression in dendritic cells mediates protective immunity against colorectal cancer.
Ko SY, Pegu A, Rudicell RS, Yang ZY, Joyce MG, Chen X, Wang K, Bao S, Kraemer TD, Rath T, Zeng M, Schmidt SD, Todd JP, Penzak SR, Saunders KO, Nason MC, Haase AT, Rao SS, Blumberg RS, Mascola JR, Nabel GJ
Nature 2014 Oct 30;514(7524):642-5
Nature 2014 Oct 30;514(7524):642-5
Robust Expression of the Human Neonatal Fc Receptor in a Truncated Soluble Form and as a Full-Length Membrane-Bound Protein in Fusion with eGFP
Seijsing J, Lindborg M, Löfblom J, Uhlén M, Gräslund T, Karnik S
PLoS ONE 2013 November;8(11)
PLoS ONE 2013 November;8(11)
Neonatal Fc receptor expression in dendritic cells mediates protective immunity against colorectal cancer.
Baker K, Rath T, Flak MB, Arthur JC, Chen Z, Glickman JN, Zlobec I, Karamitopoulou E, Stachler MD, Odze RD, Lencer WI, Jobin C, Blumberg RS
Immunity 2013 Dec 12;39(6):1095-107
Immunity 2013 Dec 12;39(6):1095-107
No comments: Submit comment
Enhanced validation
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines Caco-2 and HeLa using Anti-FCGRT antibody. Corresponding FCGRT RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and FCGRT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401327).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and pancreas tissues using HPA012122 antibody. Corresponding FCGRT RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows no positivity in neurons as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
- Sample type
- HUMAN