Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183549 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Potassium Channel Tetramerisation Domain Containing 6 (KCTD6) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCTD6 antibody: synthetic peptide directed towards the N terminal of human KCTD6
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
LRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLN
DPKPL YPMDTFEEVV- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T
DNA research : an international journal for rapid publication of reports on genes and genomes 2005;12(2):117-26
DNA research : an international journal for rapid publication of reports on genes and genomes 2005;12(2):117-26
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting