Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183014 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger, AN1-Type Domain 6 (ZFAND6) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZA20D3 antibody: synthetic peptide directed towards the middle region of human ZA20D3
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
SDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLT
GFECR CGNVYCGVHR- Vial size
- 0.1 mg
Submitted references Cloning and characterization of AWP1, a novel protein that associates with serine/threonine kinase PRK1 in vivo.
Molecular cloning of the glyceraldehyde-3-phosphate dehydrogenase genes of Bacillus stearothermophilus and Escherichia coli, and their expression in Escherichia coli.
Duan W, Sun B, Li TW, Tan BJ, Lee MK, Teo TS
Gene 2000 Oct 3;256(1-2):113-21
Gene 2000 Oct 3;256(1-2):113-21
Molecular cloning of the glyceraldehyde-3-phosphate dehydrogenase genes of Bacillus stearothermophilus and Escherichia coli, and their expression in Escherichia coli.
Branlant G, Flesch G, Branlant C
Gene 1983 Nov;25(1):1-7
Gene 1983 Nov;25(1):1-7
No comments: Submit comment
No validations: Submit validation data