HPA020625

KIAA1958 antibody from Atlas Antibodies
FLJ39294
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020625
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020625, RRID:AB_1852451
Product name
Anti-KIAA1958
Provider product page
Atlas Antibodies - HPA020625
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LIPNLKHLLSEGSHGNLTAMWGCSAGHAYHWPLTA
TCRAGSQERVCFQDNRSFNSDSPSIIGVPSETQTS
PVERYPGRPVKAKLDCNRTRDSCDFSYCSEP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -