HPA020625

KIAA1958 antibody from MilliporeSigma / Merck KGaA
FLJ39294
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020625
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020625, RRID:AB_1852451
Product name
Anti-KIAA1958 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020625
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA1958 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LIPNLKHLLSEGSHGNLTAMWGCSAGHAYHWPLTA
TCRAGSQERVCFQDNRSFNSDSPSIIGVPSETQTS
PVERYPGRPVKAKLDCNRTRDSCDFSYCSEP
Storage
-20C
Provider Type Product Number
- No reagents -