Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28023 - Provider product page

- Provider
- Abnova Corporation
- Product name
- RCOR2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant RCOR2
- Antigen sequence
PSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSS
EEEHSHDSMIRVGTNYQAVIPECKPESPARYSNKE
LKGMLVWSPNHCVSDAK- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4 Lane 2: U-251 MG Lane 3: Human Plasma Lane 4: Liver Lane 5: Tonsil with RCOR2 polyclonal antibody ( Cat # PAB28023 ) at 1:100 - 1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon with RCOR2 polyclonal antibody ( Cat # PAB28023 ) shows strong cytoplasmic and nuclear positivity in glandular cells at 1:20 - 1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)