HPA020382

INIP antibody from Atlas Antibodies

C9orf80, HSPC043, hSSBIP1, MISE, SOSS-C

Western blot: Enhanced validation

Immunocytochemistry: Supportive data in Antibodypedia

Immunohistochemistry: Enhanced validation

Provider product page for HPA020382

Antibody data

Antibody Data
References [0]
Comments [0]
Validations
Western blot [1]
Immunocytochemistry [1]
Immunohistochemistry [7]

Submit

Validation data

Product number: HPA020382
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA020382, RRID:AB_1845840
Product name: Anti-INIP
Provider product page: Atlas Antibodies - HPA020382
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDH AEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows moderate nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows strong nuclear positivity in keratinocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human thyroid gland shows nuclear positivity in glandular cells.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using HPA020382 antibody. Corresponding INIP RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

: Show more