HPA020382

INIP antibody from Atlas Antibodies
C9orf80, HSPC043, hSSBIP1, MISE, SOSS-C
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020382
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020382, RRID:AB_1845840
Product name
Anti-INIP
Provider product page
Atlas Antibodies - HPA020382
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDH
AEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -