HPA020382

INIP antibody from Sigma-Aldrich
C9orf80, HSPC043, hSSBIP1, MISE, SOSS-C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020382
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020382, RRID:AB_1845840
Product name
Anti-C9orf80 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020382
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf80 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDH
AEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNL
Storage
-20C
Provider Type Product Number
- No reagents -