H00009368-M02

SLC9A3R1 antibody from Abnova Corporation
EBP50, NHERF, NHERF1

Antibody data

Product number
H00009368-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009368-M02, RRID:AB_1580739
Product name
SLC9A3R1 monoclonal antibody (M02), clone 2B7
Provider product page
Abnova Corporation - H00009368-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC9A3R1.
Antigen sequence
NGPLPVPFTNGEIQKENSREALAEAALESPRPALV
RSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPIL
DFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFS
NL
Isotype
IgG
Antibody clone number
2B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -