HPA009672

SLC9A3R1 antibody from Atlas Antibodies
EBP50, NHERF, NHERF1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009672
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009672, RRID:AB_1857215
Product name
Anti-SLC9A3R1
Provider product page
Atlas Antibodies - HPA009672
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ
LQKLGVQVREELLRAQEAPGQAEPPAAAEVQGAGN
ENEPREADKSHPEQRELRPRLCTMKKGPSGYGFNL
HSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -