HPA009672

SLC9A3R1 antibody from Sigma-Aldrich
EBP50, NHERF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009672
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009672, RRID:AB_1857215
Product name
Anti-SLC9A3R1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009672
Antibody type
Polyclonal
Antigen
Ezrin-radixin-moesin-binding phosphoprotein 50 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ
LQKLGVQVREELLRAQEAPGQAEPPAAAEVQGAGN
ENEPREADKSHPEQRELRPRLCTMKKGPSGYGFNL
HSD
Storage
-20C
Provider Type Product Number
- No reagents -