Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183970 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-TAR (HIV-1) RNA Binding Protein 2 (TARBP2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TARBP2 antibody: synthetic peptide directed towards the N terminal of human TARBP2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQ
PNFTF RVTVGDTSCT- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Organization of the human tarbp2 gene reveals two promoters that are repressed in an astrocytic cell line.
Bannwarth S, Talakoub L, Letourneur F, Duarte M, Purcell DF, Hiscott J, Gatignol A
The Journal of biological chemistry 2001 Dec 28;276(52):48803-13
The Journal of biological chemistry 2001 Dec 28;276(52):48803-13
No comments: Submit comment
No validations: Submit validation data